SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_278730 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_278730
Domain Number 1 Region: 593-729
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.47e-17
Family Ricin B-like 0.016
Further Details:      
 
Domain Number 2 Region: 732-810
Classification Level Classification E-value
Superfamily RPA2825-like 0.00000628
Family RPA2825-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_278730
Sequence length 816
Comment | organism=Entamoeba_dispar_SAW760 | product=hypothetical protein | location=DS548626:1535-3985(+) | length=816
Sequence
MHSQSIPLFKDNNDISKGLSDQFRNIISHCNKPHFICICNDQGSNENININQIINGISSN
DYFHLQEPLKVSNETSTSETNKCNIIGPIIVSDIVKRNNLEEQEFQQILNDEVFFIEITK
LKLTSSTTLNNITGILSILQLSSVRIIHNTNEINASVLEDISSIDNLSCLLQLQGIRKEG
KRVICISSDIKTTTEKEDELTLKETILNKQKHINNHLVNFFSTKPHQTDCLCFLLPSCCP
VSQSQILCKFYKEQMRNIICEILHEIPSNCKSGSYVLSCIEILIECFKSINELNTNNIFN
EIKRLLKKKYVTTINSINMKLVGMFYEMSLDERITIIEDQSKIKNLVYQIIEKEFNPIWD
VLQIIYGDQLTNELFDSISITSKYLEEFILKDTQKIIDDLIHCNSFRLTPMWTYLTQIQI
KEQFEQNKYDSLINNYLTQTLTLNQKTLQFYSNKKCTRIDELKHQCIETIKLKTNEILNG
KQQWRDVCIKIQNYYHNLITTIDKELQTKDLSTVHQVELYHQYYLGFFKSNSEMYTVQNK
QIIFNQNDYNKILQDTFNELNDLFDKKKQIAQTLEQNHLKEELERKKEAFIRKLTSKSYY
IMPCCTTRFVLDAKYSDFKNGQPINLYWSHGNQNQHFQFIQKNDSFQIKIGHNGFLVHRS
DVSEGSVIHQWNDTTNINSFWKVIENNDGTISFLSVSNEFLAFTADSNELLASCHTRHFT
CSDYQKFKLLDTPLNNQPVPPPPENQETPKHQAQLFQTPRYAGPSIVDALKSIHADSSFS
YRERIAQVNNIQGYRGTGPQNDHMRKLLYQGRLIKP
Download sequence
Identical sequences B0EBS5
gi|165902109|gb|EDR28018.1| gi|167381564|ref|XP_001735769.1| jCVI|EDI_278730 XP_001735769.1.18373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]