SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_349410 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_349410
Domain Number 1 Region: 1-79,111-160
Classification Level Classification E-value
Superfamily MTH1598-like 1.66e-32
Family MTH1598-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_349410
Sequence length 160
Comment | organism=Entamoeba_dispar_SAW760 | product=hypothetical protein, conserved | location=DS548022:6882-7409(+) | length=160
Sequence
MSFEYLDHPADVILHSWGKNIIEAFENAAAGMFNFMSDLTRVEEKEIKTISIDATSYEEA
LVKFLDSWLCVFSSDLFIGKSFKCEVFDDNDEEHIHIECKGFVVMLRKIVFYNTNQYRIG
EYFIIGKHQQGTEIKAITWHNLEIYDDEKDQTHIHILLDI
Download sequence
Identical sequences B0E7I4
XP_001734339.1.18373 jCVI|EDI_349410 gi|165904207|gb|EDR29512.1| gi|167377267|ref|XP_001734339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]