SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_127880 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_127880
Domain Number 1 Region: 9-136
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.00000000016
Family ROO N-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_127880
Sequence length 140
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_435:57145-57704(-) | length=140
Sequence
MPITLGDVTIRHIRHSGILIEAPGIEVYIDPFQLDKVAPETLSYLETHKATHVVCTHTHF
DHLSVPDIEKIKTDKTIFIGPDACAELKTKFGNQLLRQLLCSPRPNNFKAQHLSGIRSDG
FWVLGNERFSLFACVHLVEL
Download sequence
Identical sequences jCVI|EIN_127880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]