SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_147450 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_147450
Domain Number 1 Region: 74-254
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.00000000145
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.071
Further Details:      
 
Domain Number 2 Region: 45-80
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.00000301
Family ROO N-terminal domain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_147450
Sequence length 290
Comment | organism=Entamoeba_invadens_IP1 | product=DNA cross-link repair protein pso2/snm1, putative | location=EINV_495:340517-341534(-) | length=290
Sequence
MLVADKTLRKDERERKQQAYWIEPSRVMFGEFPVDSFKYRTTMFEHYFLSHFHSDHYGGI
TKTWKHGIIVGTEFVFAENIDTLFLDTTYCDPQYTFPDRVSVSNEAVKIIKKTKEKTLYV
VGTYLIGKEIFVEEIARQTGKKICVNEQKMVTIQLSQRDLSLYTLEKTDLEMRNSGIEVS
LSGLNVELDQIKDKFQRIVLFTPTGWAKKLVSKGSFDVKEYQLPYSEHSNFNELVDCVKC
VKATHIVPTVVNPDQDPKQLIDLIITNTKPKVGTLEYAFQRARRRSSEQL
Download sequence
Identical sequences jCVI|EIN_147450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]