SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_219410 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_219410
Domain Number 1 Region: 14-237
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-71
Family Inorganic pyrophosphatase 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_219410
Sequence length 244
Comment | organism=Entamoeba_invadens_IP1 | product=soluble inorganic pyrophosphatase 1, putative | location=EINV_806:284977-285711(+) | length=244
Sequence
MSIVSLVPNFGTIRTHKEGAENAKSFRIYFEQDGKKISPWHKLPAFVDKNTVNMVCEIPR
GTNAKMEINTTTRFNPIKQDLNKDGSLRFLKHGNVLNHYGAIPQTWEDLFEKDSIVGIPG
DNDPVDIIDISSIKAARGEVTQIKPICALALLDGGETDWKVIGINVKDPNAMIINSAKDV
EKIVDEVREWYRVYKVAEGKKLNKYAYGGKAFGQRETMDVINESHLQYRKLKMTQKKLAK
LALD
Download sequence
Identical sequences A0A0A1UBW9
jCVI|EIN_219410 XP_004259471.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]