SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_289520 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_289520
Domain Number 1 Region: 12-277
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.41e-37
Family ROO N-terminal domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 242-387
Classification Level Classification E-value
Superfamily Flavoproteins 1.33e-34
Family Flavodoxin-related 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_289520
Sequence length 388
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_1042:401095-402320(-) | length=388
Sequence
MPFLPLEVVPKLHWVGVMDYDLRAFDIIMTTPFGTSYNSFLLQTAKEHVIGKEGKIDYIV
LNHTEPDHSGSLVHILAKYPEATVIATPAALNNVKYIGHIKEDTKTLSAPKIKTLDLGDI
HLKFIIQPFLHWPDTMMTVIEELKVLVTCDVFGGHCADDRVFNDKMMDRIADMDEAYKHY
FDCIFGPFKPYVLKGINLIETQMGFPVEELKAVCCSHGPVLRTNIKENIERYRQWAQPQV
LKNKVVIAYGSAYGYTKHMAEKIAEGVKSVGVEVSIHDIVRSSVDAVLKDFGDAKGLLLG
TPTLVADAIPPMMIIACNLNPVIHCDRYISCFGSHGWSGEGVKNLAVRIDQLKCKQPVKP
LCIRFQPNGDELKTCFQWGVDFATALKN
Download sequence
Identical sequences A0A0A1U896
XP_004256031.1.21224 jCVI|EIN_289520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]