SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_295740 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_295740
Domain Number 1 Region: 11-293
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.1e-36
Family ROO N-terminal domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 263-406
Classification Level Classification E-value
Superfamily Flavoproteins 4.84e-34
Family Flavodoxin-related 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_295740
Sequence length 409
Comment | organism=Entamoeba_invadens_IP1 | product=type A flavoprotein fprA, putative | location=EINV_1068:143358-144587(+) | length=409
Sequence
MENKAVKVFDNLYWVGALDTDLRVFDIIMHTPFGTSYNSFLLTTSAGNILIETVKEQFAQ
DCITRVKDVIGNGKLDYIICNHTEPDHSGSLVEILEEYPEAIVVATKPALANIEYIGHIK
KTTRTIDTTKQRQLRVGEYTLNFHIQPFLHWPDTMMTVIQEMKVVLPCDVFGAHCADSRI
FNDMMEDRIKDLDEAYKHYFDCIFGPYKSFVLKGIEMMETKFGFPVEEIRAICCSHGPVL
RTHIKENIERYRQWAQPPLLKDQVVIAYGSAYGYTEMMAKKISEGVERAGASVKMHNIVT
SSVEEVLKDFEESKGMLLGTPTLVGEALPPMYIILAHLNPIVHCSRYVQCFGSYGWSCEG
VTNLEMRINQLTVRRPVKPIAFRFKPTEENLKECEEWGYQFGNALVKGL
Download sequence
Identical sequences A0A0A1UDJ0
XP_004261408.1.21224 jCVI|EIN_295740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]