SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_311980 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_311980
Domain Number 1 Region: 12-282
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.25e-39
Family ROO N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_311980
Sequence length 283
Comment | organism=Entamoeba_invadens_IP1 | product=type A flavoprotein fprA, putative | location=EINV_1133:74133-74982(+) | length=283
Sequence
MPFLPLEVVPKLHWVGVMDYDLRVFDIIMTTPFGTSYNSFLLQTAKGNVLFETCKENFAA
ECLERIEHVIGKEGKIDYIVLNHTEPDHSGSLVHILAKYPEATVIATPAALNNVKYIGHI
KEDTKTLSAPKIKTLDLGDIHLKFIIQPFLHWPDTMMTVIEELKVLVTCDVFGGHCADDR
VFNDKMMDRIADMDEAYKHYFDCIFGPFKPYVLKGINLIETQMGFPVEELKAVCCSHGPV
LRTNIKENIERYRQWAQPQVLKNKVVIAYGSAYGYTKHMAEKI
Download sequence
Identical sequences A0A0A1UBH7
jCVI|EIN_311980 XP_004256355.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]