SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_312270 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_312270
Domain Number 1 Region: 12-296
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.68e-42
Family ROO N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_312270
Sequence length 298
Comment | organism=Entamoeba_invadens_IP1 | product=type A flavoprotein fprA, putative | location=EINV_1133:128524-129418(-) | length=298
Sequence
MPFLPLEVVPKLHWVGVMDYDLRVFDIIMTTPFGTSYNSFLLQTAKGNVLFETCKENFAA
ECLERIEHVIGKEGKIDYIVLNHTEPDHSGSLVHILAKYPEATVIATPAALNNVKYIGHI
KEDTKTLSAPKIKTLDLGDIHLKFIIQPFLHWPDTMMTVIEELKVLVTCDVFGGHCADDR
VFNDKMMDRIADMDEAYKHYFDCIFGPFKPYVLKGINLIETQMGFPVEELKAVCCSHGPV
LRTNIKENIERYRQWAQPQVLKNKVVIAYGSAYGYTKHMAEKIAEGVKSVGVEVSIHD
Download sequence
Identical sequences A0A0A1UBK7
XP_004256385.1.21224 jCVI|EIN_312270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]