SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_099530 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_099530
Domain Number 1 Region: 20-216
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.23e-23
Family Arfaptin, Rac-binding fragment 0.0097
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-23
Family SH3-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_099530
Sequence length 293
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_354:191533-192414(+) | length=293
Sequence
MTETVGTKFNRKMFQLKTHLHMKEKTHDTDLRTAKARVTENKKLYKQILHCAEALPVQAF
TPVETMRQTAEMINDKKVVEILESVGKIGFETIEQDLVVPLREHIEHYDDVQRRIDDCHK
TRIDMDRHKEKLDNLLKKTNKQGRVSEFQIKYDAECDRYSKMRSEILEETRYLDEERDTI
ARPIMSSLLLCYTLYLDTVNDKWLQIRDVLKEVPPNFKFSKEENKIVPMMVTKEQTKPLC
TVQSLYDFDATQENELSLTEGDVVDVLEENGDWWYGEINGKRGYFPSNYVRTI
Download sequence
Identical sequences A0A0A1TYJ5
XP_004185937.1.21224 jCVI|EIN_099530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]