SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_111620 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_111620
Domain Number 1 Region: 254-306
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-19
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 2 Region: 15-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000183
Family Arfaptin, Rac-binding fragment 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_111620
Sequence length 312
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_373:1004583-1005521(+) | length=312
Sequence
MSIFGNEVAKRLMKKKNKKGKTFDEEFQTIRERSRQTEQRLQGVANKISKLKAILQEASI
LQVDISNCLSELAVDNPHTTQVVNGLYEVTNEILKEQEKYNSSVFYKVEIPLLSFLEQFK
ILNNRDMELLKRRKEFLKAQSEVTKKKKKNNFEYVEKANELYRKQKEKYMALRNEINSDR
SVVMRVVPVVVEDITKKMTLEGCGCLRMNDTTWKKLTAVAQNCDKRGVETLCELITPPGK
SAVTQEVVLSKISSVFHARVVYNYNALKQNELTLREGDWVTVLSSNGQWWEGELNGTVGI
FPANYVIRDVES
Download sequence
Identical sequences XP_004260952.1.21224 jCVI|EIN_111620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]