SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_221700 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_221700
Domain Number 1 Region: 228-291
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-23
Family SH3-domain 0.00044
Further Details:      
 
Domain Number 2 Region: 43-149
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000575
Family Arfaptin, Rac-binding fragment 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_221700
Sequence length 292
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_807:40461-41515(+) | length=292
Sequence
MKKNKTSVLVPNKRNFISKVYNLKKMSGFGNLIERKFYQVKSHVGGGERTVDSDVQYSKN
KLTESHKKFKNILTVTQKLASTIHATNLMQVEVLTTLSDTRDLYNYLKTEIIDDVNKLTS
SSDEVVSPIAGTLLVSYTDYLNLINENWGLNSQAAGNFKVCAVDPTTVITPGESSMVIDA
NVFSKKSGDVSSGTYEPSEFEKSPQTSTPMQSSVPKSANGTPQRRAAPPPPQRGGPKKER
VRCGFDYTAQEQGELTFKEGDIITVMKKEGDWWMGELNGVQGYFPSNYVSPA
Download sequence
Identical sequences jCVI|EIN_221700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]