SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000199900.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000199900.1
Domain Number 1 Region: 109-157
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000484
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 79-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000392
Family Somatomedin B domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EgrG_000199900.1
Sequence length 430
Sequence
MQANLSTSAMRLVLLLLLLTVCSFNTELADRSGSCRNHDGNPICCTGRANCRGVLRVTHV
SYSYTPRGYRLADSRRFLQHAARCFCDEYCLRTNDCCWDYRDVCAKPKINCGVSAWSRWS
PCNRLCGKGNQTRTRSITREAANGGDQCPLLMESRTCSGFTCNRRRVGRSEYNSYRHMEL
PSEVANLLPVDGDIEETIKQFDMRWDIRRKLYYGRLIQQNKTDIPDPEPYSAYYEIIKSN
DACKAGGAPPRRQEGRSQNPWGSSFERIYDLDHPWLSTALLRPGQQICATCYPKYMRPEL
GNRCPGTGYPGLTSRWRALNTFDCQGTFRMISHSFSLDLLILLFAHCCLDHSHIPCPSLL
ALSSTIHLVTVSFIRPMLSSKEKHEYGCMWKAIHLSFRSSILSERVYALFFYASPSREQN
DAYVLLIFRP
Download sequence
Identical sequences A0A068WJA6
EgrG_000199900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]