SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000317100.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000317100.1
Domain Number 1 Region: 215-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-26
Family Nuclear receptor 0.0000611
Further Details:      
 
Domain Number 2 Region: 573-773
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000236
Family Nuclear receptor ligand-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EgrG_000317100.1
Sequence length 844
Sequence
MKAKIEPDEVLEEGLKTSLPSSSSSTSVSNTSSSSSGVTIPAPADSNVYTQFNYLYPVTT
ASSSSADNNDSGAPSSSSFIGLPYWSMPSASAASTIPGNGGGLDIPRYEQYPASGYYQQP
TDASRSPYTPMIIPQQLNPGYYGQTTSMPLPPQQPRPQTSQMHLTPKYPQPQAKSSVKRR
VHDTIATSSANPTPTRQRKKEPYIPSYMDTTNGPEPCVVCGDNATGFHYRAMTCEGCKGF
FRRSVQKKLEYTCKFNGNCSVGDKQNRNSCQKCRFDRCIKGGMAMDLVLDEDKRLAKRRL
IEANRARKQAEAAMAAPQQPPPPQPLPQPRQTLIPSTFSPTTSYLPHKPETINPSDFLSS
SPSSSSANSSLYWNSAGVSHNLPHQQYPSSSSTSMVQYQQSQQQPQPDANFHILEQVSQL
MPSKEAAIMAAIAAAAASASTSASPQKCDTPTNTITTTTTITRPSTSSEAKVRNTSAATS
ATSMASVAPATAVAAAASSSDEVPQPAPGLESSAAIVTPSVSAAASAAVSMGSASYNGIA
KALTEAYKSMSITAVKIGDAMKKISENNDADQSEKMNTLLEVVSNVIKSRILDVLSFAKF
VPGFLLLSVRDQTRLLQSSLLDILTLRAVEALSRKMARSTINREEDDSESDNQSVTTSKA
YAFIARSADGNSKAIRDLARKVLLWKLDVTELALVANRSDVSDPGAVVAIETLLTNVLVS
HVMKGNMDGVKLRRLFSMFSEIHSITIRNKEEFVEHLHDEVDTNEHKYLSEILLAGSEDE
ESVMVKSEEVASTSTSNNQQLGAPLSYLRVVPAIPKAYSVLPKRILSKCYIFSSLHGNGE
GLQM
Download sequence
Identical sequences A0A068WW50
EgrG_000317100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]