SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000455000.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000455000.1
Domain Number 1 Region: 290-335
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000118
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  EgrG_000455000.1
Domain Number - Region: 254-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0015
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 147-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 104-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0196
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EgrG_000455000.1
Sequence length 422
Sequence
MLPVPVDWLLIVRSCDEITFPRCSWAHFINLAQPLQMDFELFELSKSAPDISTEASVPYL
HGNCWPIRSVEQVSIIYIYAACTVYWNVSGFDRQICPQPCAQSPCSVLPFTRSGSCKTLG
IHARDFDCECIEGFTWDRNTFACISENRCERFCHPSQTATCEQDTKSTTITCVCRLGYMG
HDCSQLLDACLVGSEVYNSFEVGSAKPIIPPGREACGTENKCIPRLGTTSFSCQCKGRFT
MDRGLPYDNCLSSKDPCSSRICIEGACDGSWSMCDCEEGFAGSMCEEALGEWTTWSAWTS
CEPFCGNQRLRRRIRVCSGDREEDCIGAVEQVQLCPDGEPCPQTLSSDEVEWKDFADWFC
ILLSATVVYMGLLLLLLTILSLCKPVARTEETAQTVDLCRVTLQSRKLRYDGGDRLGTSQ
QC
Download sequence
Identical sequences A0A068WLE0
EgrG_000455000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]