SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EgrG_000745400.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000745400.1
Domain Number 1 Region: 1880-2056
Classification Level Classification E-value
Superfamily SPOC domain-like 7.06e-43
Family SPOC domain 0.0000272
Further Details:      
 
Domain Number 2 Region: 199-286
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000449
Family Canonical RBD 0.0059
Further Details:      
 
Weak hits

Sequence:  EgrG_000745400.1
Domain Number - Region: 81-157
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0041
Family Splicing factor U2AF subunits 0.043
Further Details:      
 
Domain Number - Region: 283-359
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0342
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EgrG_000745400.1
Sequence length 2058
Sequence
MLVDRAGPSSAASSHNHHHHHHHHHPHQAHQPQQQQQRQLPPQQLRFQSTASPSSSSSSN
RQSGLQGTVGSASLKVVFTPPPKYTETQIKQALCDELHKFVKTYHVNLLPAAATGGRQTR
VALVVFRRTEDEERAYLAFCNAGRCLFGAPVHVEFCSITDSEVIGSGPRIRPSPTVASVT
IHSSNSPPPSLTVPRTTRSPVFSLPTRSLIVHGLTAGPNGPVSEVQLNTAFQRFGSILQV
QMRPTSNSAIIEFVELRGSTRAMTTHQRDPLRLGGRPLRLLYTPSRPVSCLFINDIPTPL
IHQSEGELKTLFSRVVPVAQVSKITRSQESSANTTVHICALVELASQELATQLLEYLRSS
ESPLVLATQNRSPESLTTPRLPTFVCSVDFASPKQMGKVMTFAKVVETVRLKPAVMTTRP
PPPTPSFDTVNEKSRSSDLRPPLGNHRPCEQQRHESSEEEYSRSSSTSNSSLSKRFANSN
TAPPPTPAATFPSQRWSVTEAPLFIPQKRLLGSLRGELNRSHGTTTTNTVSLNLPEEVNV
CESMYDKIKRRTEGEKERRKRPCLESEEGEESRLVRRKRRRRQHYQPTLEGGLDGDTEDE
GNYEGSGEDLVEEMGLLRQRHKLKCSDSSSRRHRHGSRPSKNLPTSSSRSSVESHRQKSQ
TAKPPSKPVSTTITRLSLGMSVPMTASYHTISKSPSSCGDRRPSRLRSASGESRSGSVTS
EDTTVKSTSIRRSSYKGIKPSSLIGSRSTTEPSVSRSLSLNDVDSASGCPTLPSLPQKRI
KRQRDCVKPSTPSTATVRKTERRRLSTQTTVFRSSRVASSSLSTDDEREEKDRTHNSRPL
KWSSDAKVSLLNYNTDSKTQRLRTTSKFKAKARRTHSPSRVSDTTSSSSSSLCSVGSSRR
RRRSVDIEGVSASTPLSCGSRLAKPTPPLRSSDFHVDLSEADDGYSLDDFDRFSANTAMT
PSTEAMEISPETGEEEPEHLLSEWFTRMSSNHSDSEVEPEREQAVVEEEEEIGDSRSDDQ
KPLLISFDDINILNTSKEDSLNLSNRDAIGDIRMDDQPSPRLNESSDKSSLKSLVEETAE
PVKPPLPDEVVSPTVSAIFKPQAPPTPPKLDPGTLPPPPPPPPNVQQILSPYSSSSPTQS
LCSACSRSSPSPIITIPVQTSRSGSAANVVTETTTCVRTAVSVTQENTCVKPTEKLTPLS
ENRDLKRYVQSVIERVKAETVEDAATHRSVTSITPITSPLHHPPTASPPPLSLPPPPIPI
SLPQAGRKGALPATGRRTSGATPPGLVSTAFSPNARSATGKMLFESSGVGLLSIPGVNAC
APLSDAPSSPSKLIPEVVVEPKTLRSTTRRRAKMAMAATSAPPVPSATTTPMVAMDVATP
APKQPTDPYEPNFDDDSPPLVKPTVNATSPLVVNTSLASEHPGTASTVSSVTTTEEAVST
SDTLKGNTTRRSGLDSVDEIITDVCCGRFDMQSYLDSWGLQPPTSSSRSGPPTVTTAMPT
PMSTTAATTTAAKATETKPPVVSAPTNNPIFTAIINALQSITGSPVVIGGGANNSASGVR
QANPGVGQQLPQKASTVIVGSNPPTISATTITFPVFFKNVFSAANSSTKNAPAVAAAVSC
PIKTTVTNSHPVTMTTTPSNMSQQQLLHQQSTSTIAVSRPQSSTTDSVIESPHPYRVRCG
SDNNGPASGLIDDVISVSGSTRQPQQRPIFNPRNFTSPPPRYPPFSSPRHVSAASQPPPL
PHTPMPWSMNPMSTYPRPTRQESSPSATTATTNAFSPVSLLEKLSCFIDPDLVLPMLQSA
MQEGQHLDPDLLASLAKMFQQYGASGGDSGGIPPPSNAVTSTPSPSQTSASGGSGGGSGQ
YHHLSRAAGAATPPAPRTGSFDQTYPLVWQGRLSLKNSEVSVALHYVQGNADLLRACISN
LAAGGGGSPQQALVTSGGPLRIVQRMRLEASQLDAVQRKITQEGASCACVAFASGANRAD
LAQQNLALSDGFIRYMLEKGAAGIINVGQPGAVQGLYVVHIFPPCEFSHTLLRLAAPDLH
QSILQAQLPHLLIVITTV
Download sequence
Identical sequences A0A068W781
EgrG_000745400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]