SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000763500.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000763500.1
Domain Number 1 Region: 44-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.34e-27
Family Nuclear receptor 0.00025
Further Details:      
 
Domain Number 2 Region: 529-692
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-21
Family Nuclear receptor ligand-binding domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EgrG_000763500.1
Sequence length 871
Sequence
MLLEDVLFAREIRWLYECWFICLLVFLFLVHSNPDNAKSDASWILACPVCGDKVSGYHYG
LQTCESCKGFFKRTVQNKKAYQCTEAGVCIIDRVHRKRCAYCRFKKCLSAGMRIEAVRED
RMRGGRLRRSKSTSSPPPSSPDHEGSSEVGADGEAERVEVVEKYPSEQTSPLDPATSTAT
TPCPNQDAPTSQRAYWNPPTSSNLCGLDSINPQAVPKSENWSTPKSASSSSTTIAVAAAP
PNGPLRPFMPAAATPSSSHHAPYTPCSSTSSASIPGLYEGPAPKKETVPPLDNGAYLALT
TSEPPPNTALLGASGSGSGGQTPIPSAEELQYYPQNTSASSTSQSGGVLWSSRKSPTFRL
ADYYRPTPSQPQPLKSSGRFDQVDAGGFYTVDSSMAAEPENLEETLEEIAELEGELSSDD
EASMAEGAGELRFSNGIKTAASSAATSSVPFEGINFAQLFSASNAHSEKLIALAKQFYPK
LKEYLIRANTQGEMDLNPVEGGFMSPDNGGGPDGLGLAAATPDSPLDNILCKLSSMLEDC
LFHMVDWVNRTEIFRVIRVEDKMQLLYSSWSEVIVIEFLQCVILNLRTEDRSDMMKAGAG
SPREPSNRDLHYLVKELMEYLLPPDDENQRIRDLIARFNALNLSSHEFTCLKFLVIFNPY
KHDVNLTSSLEYVREVQADLCHFLLRAARRAIKQRPLPPPTFPTFPTHAASTLATIAASE
RLGRLLSHLTEMLLTKRGSGGRTPIAPPQPQPAPLTPSASSAYGFAASFPPPHLKRDPNG
YTPLPPPPPPWRPGSGGREDLPSASYPAPVTAATPAQYFPPTPHSVTSSDYQSSQPQPQP
QDQSFFMPPAPPPPQPPQQQHQPHTSSASVI
Download sequence
Identical sequences A0A068WC83
EgrG_000763500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]