SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000814300.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000814300.1
Domain Number 1 Region: 429-442,571-812
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.65e-45
Family Nuclear receptor ligand-binding domain 0.0000525
Further Details:      
 
Domain Number 2 Region: 357-443
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-23
Family Nuclear receptor 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EgrG_000814300.1
Sequence length 878
Sequence
MSASFRYGLSDSDRSDTKGNEVAEANNDDLSSLQDSGAKLDATHVTIQLPESMQGNSISQ
QKMQELIVHLSQSGQLKDDGKIIIEVKGSQEKGKERPSEGGSDETSDQQSVCSLKAPQQQ
THSIKYVTVQQASGTSVPSNLQKTTFIKTANGPIQTKSDVHNQSVSAQGQTEHKSSGTPA
TYHILTSSNGQHLQQSGQTQQPAYILIPATQQTQQISVAPLNSSSVASPTSAPIRVVNQG
GQHIILQHANNPSATSTPISSFSLKTASMLKDGERSVVVLQQQHQNPAPIVPVRPFVQQH
NNRLPPAPPAIAAAATSATFSTNTSTSSVRVSRGSSLGSSGKESSWQQYVKQFEKLGPCP
ICGDKISGYHYGIFCCESCKGFFKRTVQNSKRYACHMATPTSLCDITATSRKKCPACRFV
KCLEKGMRMEAIRSDRTRGGRSMYPGSRYLRQLAARASGGGEVKCELKGTSAGGVSTLPA
IAPLPNAAVVSTTSSVANEPFSKIDGVHIMSLGVSSGVAYEIPASEDVGGGVYLDPAVLE
DTGGSGPASSSTFHDESVYRLPVRTQENIDMPKILREIIKVEESVESEPEERLDFESTDA
SQIGVGALPPNVTEEEAAVYRALLNLADQRLYRIVRWSRALPVFSNLDTDDQILLLQNCW
ADLLCLDCCWKSLPTPTEIRLTSTKCINLDAAREMGAEGLVDSLLRLTQDLKRLRFGLID
FACLKVFLLMQGDLANLKAVRQVKQFQECVSQLLMDYNSTSCADVPNKFTELFVRIPELQ
RTSAMARELLVDKDLSPYLSANSLLMELLRSDFHRQPGNIMPPTSAGPVAMDTSEQATTF
LTGQRRTEDDVGGRHRSVFQTGDTIGSEASPYSANGPL
Download sequence
Identical sequences A0A068W8B9
EgrG_000814300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]