SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_000957300.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_000957300.1
Domain Number 1 Region: 500-556
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0035
Further Details:      
 
Domain Number 2 Region: 162-311
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000811
Family Regulator of G-protein signaling, RGS 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EgrG_000957300.1
Sequence length 1802
Sequence
MANLPTVADGGSFADLPPVHPASTSLSLGSGGSTSGVTTIGGTSDMTSTHLARSRVSLGA
VDRPHSSAFTNHHRRPLSLAEAPVTSPPSVSTATTANTPSGTIFQTLPSSKKNKPKHNFA
TSTAQNAATSPPSGHFLGRVLNECDSDDEQIREEICALAARFQSACSVLNSPALSAVLLN
YLLVQNHELAPILFYLVAKHYYWMQTHNKEVEKDHLRVFMEIYTTFLHEKSPLCIKVDSQ
FIRQVEDSISSGETTTVFEGCCTAVLPQIQVQVDKLNKDIRYGLDTWKPSESFDLTVAHS
YEEELSIYEMIMSPRVNELQRITTNQAPLQIGSHLSATSSLTTATSAVVAWVSSTAMATG
TPREQIASALCASLVSAYRYFAASTTATASSSPLQSDAFTEGSVIGSAPTCPNTPIPPQH
SFRKSLFAKSIENLAAVSTQVAGGTGLGSTNLSSSMSSGLATIGAINWGKLPSFNAKLKS
KSSNVIFGSWKTKIIEAAFTQHSQKGHSLQEHIFDRLTECAVCGGLIWGLAPQGLSCQVC
DVSVHHRCRAGLRESCAKDNRFYSASRGSISNVGMSVSPGISPITTASSVSRSGVLNSGT
YLPESTNASGSRVYNSWNVRKRKAHHRPSLSAMLTAESVVVTSHHKGQPTFVRKFTSPLE
DTGGSSGSRGNNSGSSGLAASTEDIFYCRNSSFNELIDESASCSSPQNPSFSLPDAVVSP
IVDGEAKVKRSNSGFGHTHRSSSQAGLTSPEPISRYVRNVKQKLDNHSYGGTGVALSKHT
ISLMQLPMMADRDPKRLIGSQNSSSSPSTSAASNVPELLPTWTGDPEMNASETFEAATEL
RIHFPDYEIPTKGPRVQDYVRTLVLLEFHQKVRYMVCYLKHFDYLLLRRWPKEHQHLADL
MALDRIPRLIRLFRSLVHAIERTVEPQGYGRMAEAVLSWLSKDDETNLKAWIRDCQALSC
TNMLDSVKAMVREYARKHPDIQMVLETRFNKFVLIESLSQVRILYFNLPLISINIMKDLE
KKTSSYKAEAKIWKEIHSKLASIPHSIDKICMPLVKLINDGHFFSTVDKGEQLSRHQAQG
GNLPFADLLLQFPRTLFRFWVIDHAEIAVDKLTLTSDNKVNYDYMKERTEVLAVLLDSAL
VLLVKDGGRYGLRPFKPSKEPGQENLTASTSNAASSSSTQFVTAPNLLGNTMKLLPVFPT
DSVFTSLGEQIGQEYMLNMIFKEQAILLRLSFTSEETRKKWLNILKRREQISAQRRLAAQ
KGRASLPSASMHFGDHKVDTKCLKTIRASVGTVQPSTNFSDPAQMVESEVPLNAPSPELI
EKQVTSFTEKISEVEQDMQALIQSMSDSQSVDANEILENLSLKPGDTVFQSNRELIILEL
LLAKNWLKFVTKHLHHLSRSPKWIRARRASATATGNASNAALTTVSERRHQRSKSAIIDV
SSGLKDRRRRPGTPSGSIYRDCLEQAPSKTSLSGSKEVVAFEARKTDGLECEEGDTKAGG
RMQLIGIIHGLQKLVESTSLIASRALSSLGTQGREGGEDSKSDDDQAEAFLDAISSLSSS
SSSSSSTETAESLTTDHVQEKGLEEVQLSDYEVEVEVEERQSGGVDEQELLERVEYAEKP
LTESVSRLDEDSMIPSPSFSKEEGEDRDNDGSYEDELRMAALQLVDDVIDSAGAYEMDLA
TIASGLAASAIVSAITHVMDDCHRDPGFSCTTDSGISFVEIPDQPSSEEDDELTVTGSKP
HLALTPTETGGPGIPFSDLDKLDPPQPPSPNGVSVGRSDSQKSTTSSGYLGSGDEIVQHD
WI
Download sequence
Identical sequences A0A068WA09
EgrG_000957300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]