SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_001010600.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_001010600.1
Domain Number 1 Region: 309-397
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-16
Family Ras-binding domain, RBD 0.0072
Further Details:      
 
Domain Number 2 Region: 439-544
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000189
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EgrG_001010600.1
Sequence length 847
Sequence
MPNSGIIQDLDDWLLKLDNLQRALKSCSTNQPRRLQLPLAPTREKQDDLYYRPLRTDQTD
KALQATQLQSPPSTSPQRQDPPPSVRRVFSSADPQQREFDPSSPVHHYFPGEQFPTPNRS
DGEYLAEQNGVQTLSQPQHQPKSKTVRWSSEPAPHRPNGMQRLVSNLDSVEADLVNAASG
CSPDRSQRGLNPSDIPEIPPPPAFTNGNNHGGDCLPHSQAIPDQISRVPKRQQFSSPIMR
YSPVPPIQNGTPPTERSSLQSQENYNTFTREKSPQAHNWVGNLNFWRSLQNRDGIDSLSL
RNQREKEDDKKVILRVHQPDRTTKAIYVQSRTDAGEVVLMLAAKNFLPLSTKMALVEKVP
SMKLERCFEDDEPVRDCILSWPVNSENLIFFEERQDLFGLFEDPQTWLGNTLVGESAQMK
NSLLIDILEKDGANRLPPFKDYLYILQPNNKWKRRYCVLRSSGLYASKKQGSDISELVRV
TAFGEHLHLYTTSGGWRKANAPTPYGFVLKPHSVVTMDPHMVRAFCAANEESLRIWCSLL
RIILMGPRLLQNYRQRLAACALNYQLPSDCAADDEEGLAALEGTSAEASVNHLAELVRHK
YARESNVYSGAGVRESARQYAKLPAIARARSVSQIQAQIATHQGSLSCSQFSLGPADRLG
ASVGDLGFVSGRTDVGRTSSMNELCVDERRATTSSTQSLNASQRLTCLFNPLRWSRRNVN
EATTPQPMRISTARKGPAARKCNRSSSSLYRPPSISPSSSVFFLQNAEDSSARVSAAVEE
EQLNSMNQRQQQLEVQQLQPQQLPTLMYPSQRRQTTAPQTPHSPRHFGPFAGIRPQLLPS
QLSPAAL
Download sequence
Identical sequences A0A068WG15
EgrG_001010600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]