SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_001032900.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_001032900.1
Domain Number 1 Region: 499-578
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-27
Family Nuclear receptor 0.0000271
Further Details:      
 
Domain Number 2 Region: 697-752,873-967
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000309
Family Nuclear receptor ligand-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EgrG_001032900.1
Sequence length 1073
Sequence
MLPYKLPEHEAFYTASFSGSERWQPSSWCRNSPPPPLPASLQEHHHFHHNHSNHRGFFCK
EDVQQTHLSNTEPTHLETLGFPGSGGAADGAPSKWEAEEACHDGSTPTLNSAPVPNSVST
SNVRSGDTFWSSTLSRVAAVAAAAMACAAVPQKNPREEHEEFENAQLGDEKAEKPDLKEP
WCRGQRKLHGRRNQTTEGTDSVLPKGQPQTPFVDSSTSPSVKSDTTVSLPFVYPSNQLPQ
LQSGSWTNMGDVNLQWSGETPNDPLKTGSNSNNSQWPSESDSAQRFYGDNQFVKPFSYSS
DEVFRSLGISTSLSEDALYVMSASKQNPSETFPQFSTTTSTPIKSELQPEFAHTHQYIDP
CQRRHSEHGEWSQKRLPPSTSYEANFTGERKPPSDIGLPLNPHMPPNSTSCDYFLESRQR
RDPYAASGTPPRGEFSPLPSYFSLFSGGGKESDPHFGSAPMLYPPVMDSGSLGAFAQSSS
GSQLPTPNRLELQQQQQQQQFCLVCGDNAACQHYGVRTCEGCKGFFKRTIQKNAHYVCLQ
TKNCIVDKRRRNRCQYCRFQKCLKVGMVKEVVRRDSLKGRRGRLSAKARCPIDGEGGGTG
DVAHKAFTVSGSSAAGQAFTLSGEKGPHQGVLSSSYGSGGVAGSTNNSASSMTLLSMLTK
AYETVDCSLEAAHLFKHPPGSNYLTKEREQQGFEKEENALIQLAVKNLGESVEVIRQYAD
LVPGFSSLSEADREKIILLHSADLITFRMAFRTAKAAAERAQLNLIHPNTSQPNAYFRSS
TSADVSRTQQQTSTIMQHQQTGPFQSVENLSAWHTQPASSESSFRPFPHTPPLTPAPPSS
WLGGGSGGSVPRPADFEAEEEEGNITVWELALSTPTEPVYIFENGSIMTDEELIRAGLGS
WIRALTWFGWQLLELAMGDHSTIAGLSALVLINYQALSGRSDLENSSDIYTVHHRFVEML
KSHCCSPTSAVAITTGYPGCYVPEADPAAATVATAATTTTMVPPARADSTYFSQVFKKKD
TVHWIASQLLLQPLQRLHASGRLPSAPECGWLNTLVSLLNSNCNQSQTSPPCS
Download sequence
Identical sequences A0A068WGH5
EgrG_001032900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]