SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EgrG_001198700.1 from Echinococcus granulosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EgrG_001198700.1
Domain Number 1 Region: 401-607
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-31
Family Nuclear receptor ligand-binding domain 0.0003
Further Details:      
 
Domain Number 2 Region: 35-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-23
Family Nuclear receptor 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EgrG_001198700.1
Sequence length 644
Sequence
MSSVIHDDRQCFTIPSSNDCSSCPPSMSARRRDEKKCAVCGDHAVGFNFGAIACESCKAF
FRRNALRATMPPCLFNGSCLIQVKTRRFCSPCRLSKCFAVGMRKSCIMDEKAKRERREKI
QRNRERKVASGQIASSDSTRGGAIARSNSPPRCYQGNTSPNPDYHSHSLAPDPPAPPHHH
QQTPPSYYPLISASHPAMATEALPSTGCHNAVNEGSGMRSTWQMPQNLHQDRLPTVEGSI
NAYSSHHLHQSHLMTPPSSSGPHPPSSFGGMESYSHPAQSLPEVQGASEATPNEAWLQLV
TSSKALEENSTTLPYFVKKPAKTVLTSSSKYPLSHANGDSKSGVKNVLDGHVWTLEPEDP
SNKECIALCPDFLKSGMARLLSKHQWTALNDLRSAYETSFLDCASDHAPESSSNITISSL
VNTSGFLVRKFINFAKKLADFSVLGQEGQICLLKGVVLNALFIRSASHYDVIKDVWVTPK
GEIPTSILKIATGMQNLYEEHAKYCRNFADVVKRDSHLVALMQVLCLFAPDRPRLSDRQS
VSNIYDRYILLLKHYLEARHGFTRGRTLLAAVLTNLAELQALTDNYGHILLHVDPSKVDP
LILEVFNLPDCKKANKDVVVVGADSSPLIMVEANTSNSNVTNPS
Download sequence
Identical sequences A0A068WSQ6
EgrG_001198700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]