SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.A01238.1|PACid:23562999 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A01238.1|PACid:23562999
Domain Number 1 Region: 38-218
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.71e-71
Family Inorganic pyrophosphatase 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A01238.1|PACid:23562999
Sequence length 223
Sequence
MELTDTEMAPPIETPQKVYENSHSSHPPLNERILSSMTRRSVAAHPWHDLEIGPGAPTVF
NCVIEISKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQ
EPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKDLPPHRLAEIRRFF
EDYKKNENKEVAVNDFLPASDAFEAIQHSMNLYADYIVESLRR
Download sequence
Identical sequences A0A059DEM8
XP_010047418.1.83385 Eucgr.A01238.1|PACid:23562999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]