SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.A02491.1|PACid:23564415 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A02491.1|PACid:23564415
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily L domain-like 3.66e-19
Family Polygalacturonase inhibiting protein PGIP 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A02491.1|PACid:23564415
Sequence length 175
Sequence
MYQAQILYLNDNLINDYCTDLAIFDLGENNLFGSIPTWLMKAFILRLQEYRFVGSIPLQL
CSLSRLKILDMVVNNLMGMILHCLGNMSNMIDFIQGLHGLNLSHNHLFGNIPIGIGNMTL
LEFFDLSNNHLSGTIPHGVLALTSLAHLNFQKEIKFKHSMILPFMPTILYSMVIF
Download sequence
Identical sequences A0A059DHT7
Eucgr.A02491.1|PACid:23564415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]