SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.C04239.1|PACid:23573628 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C04239.1|PACid:23573628
Domain Number 1 Region: 31-134
Classification Level Classification E-value
Superfamily Cupredoxins 1.43e-32
Family Plastocyanin/azurin-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C04239.1|PACid:23573628
Sequence length 193
Sequence
MAGARARTNSAVRVLVVMAVELLVMLRSAEAATYTVGGSTGWTNVVNGGASFYSSWASGN
TFNVGDILVFNFVSGQHDVAIVSESDFSSCNTGSPITLLTNPPVNYPLNTTGTVYFICTH
DSHCSQGQKLSVTVGTTSGPTTSPPGTTSPPGTATPPGTTTTPPPPPPSSGTYAYVSCGA
MFTSMAIYLFMMW
Download sequence
Identical sequences A0A059CY41
XP_010050033.1.83385 Eucgr.C04239.1|PACid:23573628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]