SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.D02652.1|PACid:23576606 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D02652.1|PACid:23576606
Domain Number 1 Region: 43-223
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-68
Family Inorganic pyrophosphatase 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D02652.1|PACid:23576606
Sequence length 227
Sequence
MSGETNANEGGEGSQSQSQSQSQPQTQRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGA
PHIFNCVVEISKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVL
ILMQEPVLPGTFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKELAPHRLSEI
RRFFEDYKKNENKEVAVNDFLPSTTATEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences A0A059CK48
Eucgr.D02652.1|PACid:23576606 Eucgr.D02652.2|PACid:23576607 XP_010054143.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]