SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.D02652.4|PACid:23576609 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D02652.4|PACid:23576609
Domain Number 1 Region: 43-187
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-42
Family Inorganic pyrophosphatase 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D02652.4|PACid:23576609
Sequence length 191
Sequence
MSGETNANEGGEGSQSQSQSQSQPQTQRPVPRLNERILSSLSRRSVAAHPWHDLEIGPGA
PHIFNCVVEISKGSKVKYELDKKTGLIKEPVLPGTFLRARAIGLMPMIDQGEKDDKIIAV
CADDPEYKHYTDIKELAPHRLSEIRRFFEDYKKNENKEVAVNDFLPSTTATEAIQYSMDL
YAEYILHTLRR
Download sequence
Identical sequences A0A059CJG5
Eucgr.D02652.4|PACid:23576609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]