SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.E01626.1|PACid:23578322 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E01626.1|PACid:23578322
Domain Number 1 Region: 102-198
Classification Level Classification E-value
Superfamily PHL pollen allergen 6.41e-26
Family PHL pollen allergen 0.00013
Further Details:      
 
Domain Number 2 Region: 9-99
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.08e-24
Family Pollen allergen PHL P 1 N-terminal domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E01626.1|PACid:23578322
Sequence length 204
Sequence
MSEKQSFARGTCGYGNGVDQALFPSMVSTGGPSLFKAGKGCGACYEVKCTENAACSGNPV
TVVITDECPAMANLGKANELRNAGVLQIQWQRVECNFPGVKATFHVDSGSNPNPNYFAAL
IEYEDGDGKLGAVNLKQALHSDSWLPMQHLWGAVWKLDGAGQLRALFSIKLTSLDSGKTL
VANNVIPTGWQPGQTYRSVVNYAV
Download sequence
Identical sequences A0A059C5F3
Eucgr.E01626.1|PACid:23578322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]