SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.F00006.1|PACid:23580661 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F00006.1|PACid:23580661
Domain Number 1 Region: 17-223
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.19e-52
Family Patatin 0.00000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F00006.1|PACid:23580661
Sequence length 238
Sequence
MERAMSLPLQPPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDV
IAGTSTGGLVTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVT
GPKYDGKYLHKLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLS
DICISTSAAPTYLPAHYFETQDSTGKIREFNLIDGGVAANNPVCKANFPYCCLMWIVT
Download sequence
Identical sequences A0A059BKD6
XP_010064131.1.83385 Eucgr.F00006.1|PACid:23580661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]