SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.F00008.1|PACid:23580663 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F00008.1|PACid:23580663
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 0.0000272
Family Patatin 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F00008.1|PACid:23580663
Sequence length 107
Sequence
MVDYHLSAVFQALHLHDNYLRIQDDTLTGALSSVDVATKKNLNDLVKTGEALLKKPVSRV
NLETGVCEPTPNQETNEEALRRFAKLLSQERQLRLARSPHGHANTQK
Download sequence
Identical sequences A0A059BIW7
Eucgr.F00008.1|PACid:23580663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]