SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.F01618.2|PACid:23582336 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F01618.2|PACid:23582336
Domain Number 1 Region: 45-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-23
Family BAR domain 0.076
Further Details:      
 
Domain Number 2 Region: 306-335
Classification Level Classification E-value
Superfamily SH3-domain 0.000000112
Family SH3-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F01618.2|PACid:23582336
Sequence length 344
Sequence
MEAIRKQATKLRDQVAKQQQAVFRQFTGVYGSDNVIADETELQHHQRLEKLYISTRAGKH
FQRDIVRGVEGYIVHGSKQVEIGTKLSEDCRKYGAENTCTTGTTLSKAALNFSRARAQIE
RERGNLLKTLGTQVAEPLRAMVMGAPLEDARQLAQRYDRVRQEAEAQGIDVSRRQARVRD
SMGNPDIVMKLEAAEAKLLELKTNTATLGKEATAAMAAVEGQQQKMTLQRLVAMVESERT
YHQRVLQILDQLEGELLSERQRIEASPSVSVDTSVPPPPPYEEINGSFASQTYDETADTI
DYFLGEVSNSGWAEGECKGKAGWFPLDYVERRERVLASKMAHVF
Download sequence
Identical sequences A0A059BQB2
Eucgr.F01618.2|PACid:23582336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]