SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.G01121.1|PACid:23586735 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G01121.1|PACid:23586735
Domain Number 1 Region: 68-298
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.97e-86
Family Inorganic pyrophosphatase 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G01121.1|PACid:23586735
Sequence length 302
Sequence
MATVRVIPAAAATTSCLLSRTPRSLKRGALGGGGAGLRLFRRPAAAAPLPSSSRRSFACS
AIYRPQVKVKEEGKPETLDYRVFLVEDSGKKISPWHDIPLQLGDGVFNFVVEIPKESSAK
MEVATDEPFTPIKQDTKKGNLRYYPYNIHWNYGLLPQTWEDPSFANSEVEGAFGDNDPVD
VVEIGESRRQIGEILKVKPLAALAMIDEGELDWKIIAVSLDDPKASLVNDIDDVEKHFPG
TLTAIRDWFRDYKIPDGKPANKFGLGNKPADKAYALKVISETNESWTKLVKRSIPPGELS
LV
Download sequence
Identical sequences A0A059BCA3
Eucgr.G01121.1|PACid:23586735 XP_010065821.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]