SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.I00855.1|PACid:23595366 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I00855.1|PACid:23595366
Domain Number 1 Region: 14-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000706
Family B3 DNA binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I00855.1|PACid:23595366
Sequence length 117
Sequence
MDKIQEMHGRDMTLVVEKTLTATDMSRGQSRLSIPNKQIRQSFLREEEIRILDRKEGIKV
SLIEPCLEVSHGLQLKRWNYKSRNFSYVLTERWNGVAHPYARNELMKDVVIQLWSFR
Download sequence
Identical sequences A0A059AMA1
Eucgr.I00855.1|PACid:23595366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]