SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.I02418.1|PACid:23597184 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I02418.1|PACid:23597184
Domain Number 1 Region: 27-208
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.23e-67
Family Inorganic pyrophosphatase 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I02418.1|PACid:23597184
Sequence length 214
Sequence
MANSGKGASGKHSAFHGVALNERILTSMTRRSVAAHPWHDLEIGPGAPAVFNCVVEISKG
SKVKYELDKTTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPILPGSFL
RARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKQLPPHRLAEIRRFFEDYKKNENK
VVNVEDFLPAESAIDAIKYSMDLYASYIVESLRQ
Download sequence
Identical sequences A0A059ARY0
Eucgr.I02418.1|PACid:23597184 XP_010029772.1.83385 XP_010029773.1.83385 XP_010029774.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]