SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.I02418.2|PACid:23597185 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I02418.2|PACid:23597185
Domain Number 1 Region: 27-179
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-58
Family Inorganic pyrophosphatase 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I02418.2|PACid:23597185
Sequence length 213
Sequence
MANSGKGASGKHSAFHGVALNERILTSMTRRSVAAHPWHDLEIGPGAPAVFNCVVEISKG
SKVKYELDKTTGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPILPGSFL
RARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKQLPPHRLAEIRRFFEDCILYDNS
VHELCLLGSCNSQYNLLCQIQSLSLLRHTIKTT
Download sequence
Identical sequences A0A059ASA4
Eucgr.I02418.2|PACid:23597185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]