SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.K00177.1|PACid:23601604 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K00177.1|PACid:23601604
Domain Number 1 Region: 43-194
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 3.84e-38
Family Pollen allergen PHL P 1 N-terminal domain 0.0000791
Further Details:      
 
Domain Number 2 Region: 174-271
Classification Level Classification E-value
Superfamily PHL pollen allergen 5.89e-28
Family PHL pollen allergen 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K00177.1|PACid:23601604
Sequence length 276
Sequence
MAALHSFRFHPSIFLCLVASFCFSRTCFGSKAKHSNLTTFGTRWSWAGATWYGSPDGAGS
DGGACGYGNAVSQPPFSSMVTGIGPSLYKSGKECGACYKIKCTKRMHPSCSGKPVRVIIT
DFCPGGPCATNSAHFDLSGTAFGAMAKAGEEVAFRDAGVLKIRYARVACDYSGRTIAFHV
DPGSNSNYFAAVIEYEEGDGDLAGVSLKEASMGPEEWRSMQQSWGAVWKLDAGSEMQPPF
SIRLTSQYSRETIVAKNVIPENWKPGSTYRSLVNYL
Download sequence
Identical sequences A0A058ZXY2
Eucgr.K00177.1|PACid:23601604 XP_010035044.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]