SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B02478.1|PACid:23567625 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B02478.1|PACid:23567625
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily SAP domain 4.58e-16
Family SAP domain 0.0049
Further Details:      
 
Domain Number 2 Region: 101-164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000709
Family PHD domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B02478.1|PACid:23567625
Sequence length 872
Sequence
MDLVSSCKDKLAYFRIKELKDVLTQLGLSKQGRKQDLVERILSALSDEQVSKMWAKKHVG
KEDVAKLVDDIYRKMQVSGAPDLASNGQGASDCSNVKVKGESIDPYRSDAKVRCPCGNSL
ETETMIMCEDPRCHVWQHMSCVIFPEKPEEAPENFYCELCRLSRADPFWVSVGHPLQPVK
MVTTNIPADGTNPIQSVERTFQLTRADRDLLVKQEFGLQAWCMLLSDKVSYRMHWPQYAD
LQINGSPVRAINRPGSQLLGANGRDDGPIITQIVKDGINKISLTGCDARIFCLGVRIVKR
RNVQQILNLIPKESDGERFEDALARVCRCVGGGATEADSDSDLEVVADSFAVNLRCPMSG
SRMKVAGRFKPCLHMGCFDLEVYVEMNQRSRKWQCPVCMKNYSLENIIIDPYFNRVTSLM
RNCGEDVTEIEVKPDGSWRVKTKTESERRDLGNLSQWHLPDSTLCLLTEENSPPNAEYLK
QIKQEGVSDSHTGLKLGIRKNRDGIWEVSKPDELNNSSSNRLLDKFGDHELKVIPMSSSA
TGSGRDGEDPSVNQEGGGNFDFSTHNGIELDSITLNVDPSFGYTDQIPSAPMGDAEIIVL
SDSDEENDILVSPRSIYKNDHSEPSGINFSMPHAGIADTFEDPALGTGANSCLGLFNSNT
DDFENMHLWSLPPGTQGGPAFQLFGSDGDVSDALADLQHGSMNCTSSTNGYALAPVTMTE
APALVPDPSVGHADDSLNDNLVDNPLALGRVDPSLQLFPSAASLQPNIRDQSDMSNAPRT
EDWISLRLGDGATGGHCEPPTANGFTPGQQIPSGEGSMETLADTASLLLGMNDGRSEKAS
RQRSGSPLSFPRQKRSVRPRPRLYLSIESDSE
Download sequence
Identical sequences A0A059D529
XP_010043707.1.83385 Eucgr.B02478.1|PACid:23567625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]