SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B02559.1|PACid:23567739 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B02559.1|PACid:23567739
Domain Number 1 Region: 222-346
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.45e-31
Family Ribonuclease H 0.0025
Further Details:      
 
Weak hits

Sequence:  Eucgr.B02559.1|PACid:23567739
Domain Number - Region: 86-134
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00131
Family N-terminal domain of RNase HI 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B02559.1|PACid:23567739
Sequence length 367
Sequence
MNYLSRVPSYTAAISKRAARLIGGRPFVERASAPAWGGAFRNAALRSANSEPVLCRYGVR
CYSSKRGKRAGSKSATAAVVDPEKDSFFVVRKGDVVGVYRSFLECQAQLGSSVCDPPVSV
FKGYKMSADSEDYLTSRGLKDAIYTINIADLKDDIFGMLTPCPLQEPAAYRGEDTETNGP
KETSHDALEEEVSVTVSTDPSVKHVSSNLNYEGVPISLNCNSCILEFDGSSKGNPGKAGA
GAVLRAEDGSVICVLREGVGTATNNVAEYRAVILGLKYALEKGCRSIRVRGDSKLVCMQV
QGLWKVRHKKMSELFQVVNKLKQNFHSFEISHVLRGLNSDADAQANKAILLADGQIEEEC
VELVQMA
Download sequence
Identical sequences A0A059D5W6
Eucgr.B02559.1|PACid:23567739 XP_010046450.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]