SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.D00347.1|PACid:23574129 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D00347.1|PACid:23574129
Domain Number 1 Region: 46-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-20
Family BAR domain 0.021
Further Details:      
 
Domain Number 2 Region: 265-318
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D00347.1|PACid:23574129
Sequence length 331
Sequence
MDALRKQASKLRDQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRATRAS
KDFQKDIVKAAETFTALGYKHIETGTKLSEDCCKYGAENIHDNILAKAAAVYGDSLKHVE
KEQEDYNKLLYSQILEPLRASYGYWGSQMLAAEISRRQARVRESPIPENVAQLHAAEAKM
QELRANMAVLGKEAATALAAVGSQQQKVTFQRLVSMVEGERTYHLRVAAILGEVEAEMVS
EKQRKESAPPVFLLENNSEKTAYFLAEAVHNFDAESEKELSLAVGDYVVVRKVSPSGWSE
GECKGEAGWFPSAFVEKRLRLPTDGMVAEVY
Download sequence
Identical sequences A0A059CCA6
Eucgr.D00347.1|PACid:23574129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]