SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.D00462.1|PACid:23574231 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D00462.1|PACid:23574231
Domain Number 1 Region: 12-252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.44e-56
Family Legume lectins 0.0000204
Further Details:      
 
Domain Number 2 Region: 324-429
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.63e-20
Family Protein kinases, catalytic subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D00462.1|PACid:23574231
Sequence length 451
Sequence
MIFIASVLCEGFSFNFPAFDDRIVPEGNASLSTSHVQLTVSDKGENLGCSMGRATYHDPL
HLWDDSTGNVADFSTQFSFVIYSEHNDTFADGLTFFHVPNGSDIPSNSSGGHLALVSRNR
DHSDPCTTFVAVEFDTCYYNYWDPQCHHVGIDLNNISSVNYTCVNWLQNKIERDGHINAS
ITYGSSTQMLSVLMIDVEYPNLNVAKLSHSVDLTNYLPEWVMVGFSATTRYRFELPTLHS
WEFRSNLRVTDSGNRTNHTSPAERNTGDNVRAKESKSWVWSLIGLGSLLLVALVLGFAWF
GYRLNRIGEENDVPSIDEEFDRVTGPKIFYEDMVTATNDLADARLLGEGGFGRVYEGCLL
GVNTIFAIKKITPKSRQGIKEYVTKVTISRLRHRKLVQLIGWFHEKKIPLLIYEFISNGS
LDSLIQAPNLFDVGKAVLNCTRPSLGIAIPA
Download sequence
Identical sequences A0A059CDS5
Eucgr.D00462.1|PACid:23574231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]