SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.E01201.1|PACid:23577920 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E01201.1|PACid:23577920
Domain Number 1 Region: 45-254
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-25
Family BAR domain 0.036
Further Details:      
 
Domain Number 2 Region: 302-359
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-16
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E01201.1|PACid:23577920
Sequence length 371
Sequence
MEAIKKQASKLREQVAKQQQAILKQLGHFDADALMVDEDELQCYRQLQNLYNSTRVAKHL
QRNIVRGVEGFISISSKQMAIVRKLADDCCNYGVENQGSGSALSRAALSFGTSHNSMESE
RANLLGTLGDQVSEPLRVVINGAPLEDARHLTRRYDKLRQEVENQAAEVLRRRSRSRDST
QSAESTLKLKSAEARLTELKSAMMALGREATDAMLSVENQQQQITFQRLLKMVDVERDYH
RRVVAILEKLHSEMIEEEQSSEPSVTSTTLQRDGEVPLAHEDDKSSISDDHGHIDQYESY
FIGKVIHSFDAQAEGELSLFVDDYVIVRQVAPNGWSEGECNGNAGWFPSAYVERQEKAPA
KKVLETTSARI
Download sequence
Identical sequences A0A059C478
Eucgr.E01201.1|PACid:23577920 XP_010056148.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]