SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.E01352.1|PACid:23578074 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E01352.1|PACid:23578074
Domain Number 1 Region: 1639-1930
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-125
Family BEACH domain 0.0000000101
Further Details:      
 
Domain Number 2 Region: 2054-2122,2160-2274,2314-2361
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.92e-26
Family WD40-repeat 0.0078
Further Details:      
 
Domain Number 3 Region: 1519-1629
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-22
Family PreBEACH PH-like domain 0.0023
Further Details:      
 
Weak hits

Sequence:  Eucgr.E01352.1|PACid:23578074
Domain Number - Region: 89-350,591-684
Classification Level Classification E-value
Superfamily ARM repeat 0.0374
Family GUN4-associated domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E01352.1|PACid:23578074
Sequence length 2390
Sequence
MARLASRGGDVLPAFGSGAGLPWLATNDHARNMAEASAVLDAEIGGCIHLFYHPSLLTGR
FCPDASPSGAAGTLRRPAEVLGQVHVATRMRPVEALWALAYGGPMSLLPFVVANVDKDSL
EPQLGDPSLSLATTNLAAPIFRIIAGAIHHPGNNEELCRVRGPEVLSRLLDHLLQTLSAI
NVGQSDGVADEELVAAIVSLCQSQKINHALKVQLFGRLLLDLKIWSLCNYGLQKKLLSSL
ADMVFTESSVMRDANAIQVLLDGCRKCYWIIREKDSVDNFSINDTARPVGEVNALVDELL
VIIELLIGSAPPSIAADDIRCLLGFLVDCPQPNQVARVLHLVYRLVIQPNTSRAHMFAEA
FIACGGIETLLVLLQRETKAGDESIPELSTENNKSLSPQGLQLESSTGFSEVSQDNEVGA
LEVNESISNEMHHDNSPNGSSGTPVSSGLKIERMISVSENPFLKNLGGITLSISAANARN
NVYNVDKIDGIVVAIIGLLGALVSLGLLNFGSPAPSDMTTNLVGSGLHEVGSTMFDDRVS
LLLFALQKAIQAAPNRLLTNNVYMALLAASINASSSDDGLNFYDSGHRFEHSHLLLVLLR
SLPYASRSLQSRALQDLLFLACSHPENRNSLTTMEEWPEWILEILISNYEMGAVNHSTSP
SLGDIEDLIHNFLIIILEYSMRQKDGWKDIEATIHCAEWLSIVGGSSTGDQRIRREESLP
VFKRRLLGGLLDFAARELQVQTQVIAAAAAGVAAEGLSPKDAKVEAENAAQLSVALVENA
IVMLMLVEDHLRLQSKLSNASRATDISPSPLSLVSPLNNRSNSSTNVGESSAPMDDRRSL
SSDSAGLPLDVLASMADANGQISATVMERLTAAAAAEPYESVSCAFVSYGSCAVDLAEGW
KFRSRLWYGVGLPSKDSVLGGGGSGWERWKSALEKDANGNWIELPLVKKSVAMLQALLLD
ESGLGGGLGIGGGSGTGMGGMAALYHLLDSDQPFLCMLRMVLLSMREEDDGEDRMLMRNI
SIEDGISDASNRMVGNLMALDSNSRMSTRKPRSALLWSVLSPVLNMPISESKRQRVLVAS
CVLYSEVWHAVGRDRKPLRKQYLEAIVPPFVAVLRRWRPLLAGIHELATADGLNPLIVDD
RALAADALPVEAALSMISPSWAAAFASPPAAMALAMIAAGAAGGDAPAPITSTQLKRDSS
LLERKTTRLHTFSSFQHTGEVPSKSPVVLKDRAAAKAAALAAARDLERNAKIGSGRGLSA
VAMATSAQRRNASDMERVRRWNLSEAMGIAWMECLQSVDRKSVYGKDFNALTYKFVAVLV
ASFALARNMQRSEVDRHTQVDQFARHHLYAGNNGWRKLIHRLIEMNSLFAPFGDRLYDSA
MVFWKLDSLETSSRMRLCLRRNYKGCDHYGAAADHEDPVEKKLDQKNVMDPPGAPALTTD
AISIELVNEDDEQAEIDNIEGKTSNVDQSEENQSSLSGKTQQNLQAVAESGDIQFGSEQD
LVQSSSAVAPGYVPSQVDERIVLELPSSMVRLLRVVRGTFQVTTRRINFIVEHVVDSNYT
DDMEDKSESMEDEKDYSWPISSLHQIYSRRYLLRRSALELFMVDRSNFFFDFGSIEGRRN
AYRAIVQAHPPHLSNVYLATQRPEQLLKRTQLMERWARREISNFEYLMHLNTLAGRSYND
ITQYPVFPWILADYTSKNLDLSDPSSYRDLSKPVGALNPDRLEKFQERYSSFDDPIIPKF
HYGSHYSSAGTVLYYLMRVEPFTTLSIQLQGGKFDHADRMFFDIAATWNGVLEDMSDVKE
LVPELFYLPEILTNENCIDFGTTQMGDKLDRVKLPPWAESPIDFIHKHRMALESEHVSEH
LHEWIDLIFGYKQRGKDAISASNVFFYVTYEGAVDIDKISDPVHQRATQDQIAYFGQTPS
QLLTVPHMKRLPLADVLHLQTIFRNPKEVRPYTVPTPERCNLPAAAMHASSDSVVIVDIN
APAAHVAQHKWQPNTPDGQGTPFLFQHAKAATSSTGGTFMRMFKGTAAPGSDDWKFPQAL
AFPTSGIRGSAIVSITSDKEIITGGHADNSIKVISSDGAKTLETAIAHCAPVTCLALSPD
SYYLVSGSRDATVLLWKIHRGFGTGSSSLSDLPTSTGTPTSSTNSTQTILADKSRRRRIE
GPIHVLRGHLREISCCCVSSDLGIVVSCSYSSDVLLHSVRRGRLIRRLAGVEAHAISLSA
KGVIMTWNELRHTLSTFTLNGVPIATAKLPLSCNISCIEISLDGENALLGINSSSENSGS
FNSNKDLNFKSSVLEESDKELDETGQMLDIQSPSLCFLDLHTLKVYHTIKLADGQDITAV
VLNKDNTNLLVSTADKQLIIFTDPALSLRVVDQMLKLGWEGDGLSPLIKP
Download sequence
Identical sequences Eucgr.E01352.1|PACid:23578074 Eucgr.E01352.2|PACid:23578075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]