SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.F00430.1|PACid:23581123 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F00430.1|PACid:23581123
Domain Number 1 Region: 2520-2804
Classification Level Classification E-value
Superfamily BEACH domain 2.35e-122
Family BEACH domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 2910-3172
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.35e-38
Family WD40-repeat 0.008
Further Details:      
 
Domain Number 3 Region: 1085-1272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.65e-20
Family Clostridium neurotoxins, the second last domain 0.031
Further Details:      
 
Domain Number 4 Region: 2335-2388,2438-2490
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-18
Family PreBEACH PH-like domain 0.0071
Further Details:      
 
Domain Number 5 Region: 763-1086,1504-1715
Classification Level Classification E-value
Superfamily ARM repeat 0.000023
Family MIF4G domain-like 0.064
Further Details:      
 
Domain Number 6 Region: 1401-1456,1491-1571,1645-1715
Classification Level Classification E-value
Superfamily ARM repeat 0.0000619
Family Regulatory subunit H of the V-type ATPase 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F00430.1|PACid:23581123
Sequence length 3188
Sequence
MNIVKGVADLIRRTSSGQTGDSSSGLQGERFPPPAPKIRFSEVGDEAILYTLWERYEKEV
DKVEKKKLFQVFLKQFLTVYENWEPVNYGQFSEASVSSEPLGEYSSHVDDIVSGCSIGHP
AGVISIFIQEIAQLTTLINELSSSIMQSNINLVGPSTSFIVTSEGIPVLVALSIVTRSMH
NCRVFDYYGGVQKLTALMKGAVVQLKTITGSLSADENFSNFTLEKIKLLQQILVHVVSII
YSFIDWIPHSYKKAQFDSSISCCNLPRKSPSVFDSDSVMNIPMSETRSLWHQKAVVSLME
AGGLNWLVDLLRVIRRLSMKEQFMDVNLQHLTLKSLLSALSGNLRGQNHFKSIGGLEVLL
DGLGLPTNNVYNLKNIFNVIEKRDENPLLHLLRLHILSLEVLREAVFGNLSNLQFLCENG
RTHKFANSFCSPAFFFQEHKQQDKVLPHQDNLESDKQSTTNPASPITLPSDGFSSHLWVD
YIVKLSIVLCSFLYAPEDVSSHHVQGALNRAAMPGYPAYGELSVKWVLKVLLTVFPCIRV
FSDQTELPSHLRIFINTLQHFTLNAFRKVLVSLPASIEVFRDEGLWELFFSENFFYFGSA
FHESCTEICKSHEGSSAMCEVSSSNFTVNQLKASHTEILQMEIISFVELAATSRESVHNL
PELSVLLDALEQCAYNSRLSSALARSLLHILQLSAEKTLASFKALDAIPRILKVVCIQAQ
ELRRSRKTGPSLGSKETVVPAHRAQESDSSDTAQNWQKSMETAMNIFSEYLSSDDEAKLS
ILVGSTSVDCLFDLFWEEDLRRCVLNHILDLMKIVPSSAEDQKATLYLCSKYLETFTQIK
EHGKSFVELSIDLLVGIREMVQSNLEYYQALFREGQCFLHVVSLLNGNLDMVKGEELVLN
VLQTLTCLLAGNDVSKIAFRALVGSGYQTLQSLLLDFCQWQPGEALLNALLDMLVDGRFD
VKSNYIIKNEDVIILYLSVLQKSSASLRHHGLNTFQLLLRDSISNRASCIRVGTLSFLLD
WFSQEDDDHVIMRTAQLIQVMGGHSISGKDIRKIFALLRSEKVGARQQYCSLLLTTVLSM
LNERGPTAFFDLSGSDSGIQIRSPIQWPLNKGFSFSCWLRVENFPRNGAMSLFSFLTENG
RGCVALLSKDRLIYESVNLKEQSVGLQVNLVRKKWHHLCLTHSIGRAFSGGSLLRCYLDG
DLVSSDRCRYPKVNEQLTHCTIGAKVSLSINEEDGVIESRSSFAFHGQIGPVYLFNDAIT
PELVQGVYSLGPSYMYSFLDHEIAPFSNNQLPSGILDAKDGLASKVVFGLNAQASDGKRL
FNASAVLDHALDRNLFEANVMVGTHLCSRRLLQQIIYCVGGVSVFFPLIAQSERYEHEES
GEFENALLVPITKDRLTAEIIELIACVLDENLANQQQMHILSGFSILGFLLRSVPPQQLN
LETLSALKHLFNVIANCSLGEVLVKDAIAGVFLDPLIWVYTAYRVQRELYMQSITAADVK
ALVSFFESSQDMACIEDVLHMVIRAISQKPLLASFLDQVNMIGGCHIFVNLLNRDFEPIR
LLGLQFIGRLLVGIPSEKKGTRFFGLGVGRSRSLSESYRNISTRMQPIFSAISDRLFKFP
QTDNLCATLFDVLLGGASPKQVLQKHYQIEKQRTKGNGSHFFLPQVLVLIFKFLSGCNDA
SVRMKILRDLTDLLDSNPSNIEALMEHGWPAWLTASVKLDFMKNYGVESLGDGEGERSEQ
SLVRNLFCVVLAHHIHSVKGGWQQLEDTVNFLLMHSEQDGMPCHKLLHDIFHDLVQKLVD
LSSEENMFVFQPCRDNTLYLLKLVDEMLISELDNKLPFPASSSDFTLVSLDLDSHKEFSN
ALQEVLRGASNESPSRNPQFGKQPSAKEDNIEGDRWWNLYDNLWILISEINGKGPSRMLP
KSSSSVGPSFGQRARGLVESLNIPAAEMAAVVVSGGIGNALGGKPSKSVDRAMLLRGEKG
PRIVFRLVILYLCSSSLERASRCVQLFVSLLPCLMVSDDEQSKMRLQLFIWALLSVRSRY
GMLDDGARFHVISHVIRETVNCGKSMLATSIAGRDDPSDSGSISKERSTIQNLIQKDRVL
AAVADEAKYMKALKTDRSRQLNELCSRLEEISSAELSSSRTFEDEIQSSFNNIIASDDNR
KAAFQLCYEEQQQNVAEKSMHLFRILIDERGPWSANAFPNSAVRHWKLDKTEDRWRRRQK
LRQNYHFDEKLCYPPSIAPQDETTPPVNESKYGFAGHIPEQMKRFLLKGVRKITDEASAE
PNENEDEVCVQKISAPEDSPEAQHDVIVKDGNDHKDFSQDRVDSSASSPEAEISDEVLIS
APCVLVTPKRKIAGRLAVMKTALHFFGEYLVEGTGGSSAFKDFQQPSNSDLSKLDQKQRF
SKWPPHIYMESDKGISFNGLELLSENVHQRDLKNLKRHRRWSIGKIKAVHWTRYLLRYTA
TEIFFSDSSAPIFLNFTSQKDAKEIGTLIVTTRNEFLFPKGSSKDKHGVISFVDRRVALE
MAEAAREKWRKREINNFEYLTILNTLSGRSYNDITQYPVFPWVLADYSSEVLDFNKSSTF
RDLTKPVGALDSKRFEVFEDRYSNFCDPDIPSFYYGSHYSSMGIVLYYLLRLEPFTTLHR
NLQGGKFDHADRLFQSVEGTYRNCLSNTSDVKELVPEFFYMSEFLVNSNSYHLGVKQDGE
PIGDVCLPPWAKGSPEEFVNKNREALESEYVSSNLHHWIDLVFGFKQRGKPAVEAANIFY
YLTYEGAVDLDSMEDDLQRAAIEDQIANFGQTPIQIFRKKHPRRGPPIPIAHPLYFAPSS
INLTSVLSSIIDPPSAVLYVGQLDSTVVLVNQGLILSVKMWLTTQLQSGGNFTFSGSQEP
FFGVGADFLSPRKIGSPLSETCEFGAQCFATLQTPTENFLISCGNWENSFQLISLTDGRL
VQNIRHHKDVVSCVAVASDGSVLATGSYDTTVMVWEVYRVKTPERRLRNLQAEIHRKDYV
VVETPFHILCGHDDIITCLYISMELDIVISGSKDGTCIFHTLREGRYVRSLCHPSGSALS
KLVASRHGRIVLYADDDLSLHLYSINGKHLASSESNGRLNSVELSSCGEFLVCSGDQGQI
VVRSMNTLEVVQRYNGVGKIITSLVVTPEECFLAGTKDGSLLVYSIDNPQHRKSSHPRNV
KSKSASMG
Download sequence
Identical sequences Eucgr.F00430.1|PACid:23581123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]