SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.F01618.3|PACid:23582337 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F01618.3|PACid:23582337
Domain Number 1 Region: 258-314
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000328
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 2 Region: 45-210
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000165
Family BAR domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F01618.3|PACid:23582337
Sequence length 323
Sequence
MEAIRKQATKLRDQVAKQQQAVFRQFTGVYGSDNVIADETELQHHQRLEKLYISTRAGKH
FQRDIVRGVEGYIVHGSKQVEIGTKLSEDCRKYAMVMGAPLEDARQLAQRYDRVRQEAEA
QGIDVSRRQARVRDSMGNPDIVMKLEAAEAKLLELKTNTATLGKEATAAMAAVEGQQQKM
TLQRLVAMVESERTYHQRVLQILDQLEGELLSERQRIEASPSVSVDTSVPPPPPYEEING
SFASQTYDETADTIDYFLGEVVHPFRGVSDVELSLSAGDYVVVRKVSNSGWAEGECKGKA
GWFPLDYVERRERVLASKMAHVF
Download sequence
Identical sequences A0A059BPE3
Eucgr.F01618.3|PACid:23582337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]