SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.F01756.1|PACid:23582490 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Eucgr.F01756.1|PACid:23582490
Domain Number - Region: 487-514
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0955
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F01756.1|PACid:23582490
Sequence length 627
Sequence
MECRLVGKNEATYLELLEIAVWKQNLFAVHHIWKDYSKHYNFCLTSLRKFIWSFTRLRDL
KSAYESLQLMVALATEGTLSNRYAERASHSPKLDIPIPAMSELRLERFDKDDTEHICHKE
DGLALNMGQSTTYGPRKEVMCVGTDTPNPKYLALRNVLSRSFTDVICTCALTSNHSLAEQ
LFQQMQNLGLQPSSRTYDGFIRAIVTERGFSDGLELLKIMQKQKLGPFDSTLAAISVKCS
EALELDFAEALLVQISECPHPYPFNVFLAACNAVDQPERAVRVLAKMKQIQLQPNIQTYE
LLFSLFGTVNAPYEEGNMLSQVEAAKRIETIEMDMARNGVDHSLISLKNLLAALGQEGMI
EKMLRVVETRFLCSGTYVEAPLFNVVLHSLVAAKENRKAVDIFKNMKQRGFSPDHATYCI
MIDCCSIIQCYRSACSLVSMMIRDGFYPGIMTYTALIKVLLVCENYDEALNILDQAKEER
IQFDLLLFNTFLLKACEMGRLDVLEHIIEQIHQEKIQPDPSSCCYVYNAYVNNGFYSTAI
EALRVLSMRMICQADNPLQETRAEYEDFIFSEDPNAESYLTHFFEDNQDDLAFALLNLRW
CAIEGMPIDWLPEQSPWAQRLARCTQE
Download sequence
Identical sequences A0A059BPF6
Eucgr.F01756.1|PACid:23582490 XP_010061154.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]