SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.F03577.1|PACid:23584704 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F03577.1|PACid:23584704
Domain Number 1 Region: 26-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-55
Family Legume lectins 0.0000284
Further Details:      
 
Domain Number 2 Region: 337-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-51
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F03577.1|PACid:23584704
Sequence length 607
Sequence
MSCSLPLCTLLILFSLVYSHVILFVSSLSFNISSFNTNGGDILLEGVATIVAGSVVLTQG
KVAPVYEVGHMRYAESIAIKDSTTGKQADFSTNFSFTIDSYNYSLHGDGIAFFLAPVGFS
IPPNSAGGYLGVFNESTVYGPYRIVVIEFDISLSGIPFDLPTEHIAIDVNSASPKAHEPW
NFTAYDGKATNVMVTYDSTSKNLSLFWSLDDQPIPSDSKSSSLSHQVDLAEVLPESVFIG
FSASNGAFSAKHSINSWEFTSNLDVVPGPPVDLPNGVKEDMSKGGVSKMYRMVTFITFPI
ACLLLVISAGSCLFMIKKRKKNEFQALTHTDKEIVALPLKFSYQELLVATNDFASDRRLG
QGGSSQVYRGLLNRFDRLVAVKRIFAESKHSEKVFTNEVKILSRMIHRNLVQFIGWCQEE
GEFLLVYEYMPNGSLDNHLFGTRKNLPWDLVDPQLRTRTTDVVGTYGYLAPEYLSEGKVT
KESDMFSFGVVALEIACGRRTYQEGEFHIPLRKWVWQLYLAGNMLEAADESLGSSFDRKE
MECLMMVGLWCVHPNPKMRPKAGQVIRFLQLEVPVPEFPSVDHLVDGDVTKTSVPLKTPT
SAKACIA
Download sequence
Identical sequences Eucgr.F03577.1|PACid:23584704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]