SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.G01018.1|PACid:23586627 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G01018.1|PACid:23586627
Domain Number 1 Region: 162-473
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-83
Family Protein kinases, catalytic subunit 0.0000895
Further Details:      
 
Domain Number 2 Region: 6-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-20
Family Legume lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G01018.1|PACid:23586627
Sequence length 514
Sequence
MNDKILHGQQLHAQVTYNSTAMNLSFVFQDDDDNYTSLYYQPVNLREYLPEWVVFGFSAT
TGQLFEAHTIFSWEFNSSLQILDDVNGTTNVTPVDTPTRGKKSKSWVKGAILGLSSLVLI
ILVPGFGWYGYKLKRNRNDRSGEEEEEEDAPGIDEGFEQSRGPKEYSYNVLAVATNNFAN
TRLLGEGGFGGVYEGHLADTNSHVAIKKITPESKQGVKEYATEVKTIRHLRHKNLVELIG
WSHERNKFLLVYEYMSNGSLDSHLFKDKMPLPWEKRYNIAQGIALGLKYLHEDLKQCVVH
RDIKSSNILLDAQFEAKLGDFGLARIVDHAKGSQTTLLAGTMGYLAPECIYTGKASKESD
VYSFGVVLLEIACGRRAIEPRALQGQIQLVEWVWELYGIGKLFNAVDPKLVENFDGRQME
RLMIVGICCAHPDPKERPPISKVITFLNFDTSPPILPPKLPIPTYIVPPSSIPESLHVLS
SSFRRSEPRSTYVFDVDFDVKMWCMSVYGKIVDT
Download sequence
Identical sequences A0A059BBH0
Eucgr.G01018.1|PACid:23586627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]