SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.G01923.2|PACid:23587494 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G01923.2|PACid:23587494
Domain Number 1 Region: 208-433
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.31e-61
Family Mitochondrial carrier 0.0001
Further Details:      
 
Domain Number 2 Region: 37-208
Classification Level Classification E-value
Superfamily EF-hand 1.27e-33
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G01923.2|PACid:23587494
Sequence length 433
Sequence
MEARAKNEKGRRSDGCNPVRKPGPVTMDHVLLASGETKEKRELRIRGMFDSFDTAKVGYL
DYAQIETGLSALHIPPEYKYAKDLLNVCDANKDGRVDYQEFKRYMDDKELELYRIFQAID
VEHNGCILPEELYDALLRAGIEIDDEELAHFVERVDKDSNGVITFEEWREFLLLYPHEAT
MENIYRYLERVCLVDIGEQAVVPEGISKHVHTSRYLIAGAVAGAASRTVTAPLDRLKVIL
QVQTTRASLMPAIKSIWKDGGLRGFFRGNGLNVVKVAPESALRFYTYEMLKRVIVTAQGG
EEKAEIGPMGRLLAGGVAGAVAQTTVYPMDLVKTRLQTHVSDGGKIPSLGQMTRDIWVQE
GPRAFYRGVVPSLIGIIPYAGIDLAAYETFKDLSKKYILQDGEPGPLVQLVCGMTSGALG
ASCVYPLQVVRTR
Download sequence
Identical sequences A0A059BEG3
Eucgr.G01923.2|PACid:23587494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]