SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.G02930.1|PACid:23588701 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G02930.1|PACid:23588701
Domain Number 1 Region: 316-574
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-71
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 26-265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.43e-62
Family Legume lectins 0.00000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G02930.1|PACid:23588701
Sequence length 603
Sequence
MSCSLSLCTLFILFSLVCYPVIPLVSSLSFNIDSFDTNLNTILYEGTARSKSGSVELTNS
YIQPGYQVGRIQYSKPINIWDSGTGRQADFFTRFSFTISTNNATEYGDGMALFLAPVGFP
IPPNSAGEFLGLFNASTFEDPRNQIVTVEFDTYVNPQYDPPVQHIGINKNSLSSLVYAGW
NAGSHSGNATDVMVTYNSTTKNLSVFWSFDDEPVSLDNKSSLLSCQIDLAKVLPESAAIG
FSASVGRVSERHILNSWEFTSNLDVIHPPSTDTSKKGVKSKMYRLITFITVPVACLLLVI
AAGSCLFMIKMRKKFYKGFLSSLDRLVAVKRIFAESKHSEKVFTNEVKIISHMIHRNLVQ
FIGWCQEEGEFFLVYEYMPNGSLYNHLFGTRKSLPWDVRYKIASGLALALNYLHEELEQC
VLHRDIKAPNILLDTNFNTKLGDFGLAKLVDPRFRTPMTDVVGTYGYLAPEYLSEGKVTK
ESDMFSFGVVALEIACGRRTYQEGEFHVPLHKWVWQLYLAGNMLEAADESLISSFERKEM
ECLMMVGLWCAHPDPKRRPKAGQVIKMLQLEVPVPEFPRGTCENSVPVQQDRSWLLKPSS
ETC
Download sequence
Identical sequences A0A059BIM6
Eucgr.G02930.1|PACid:23588701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]