SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.H00062.1|PACid:23589387 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H00062.1|PACid:23589387
Domain Number 1 Region: 165-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-78
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 2-204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.12e-33
Family Legume lectins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H00062.1|PACid:23589387
Sequence length 507
Sequence
MVEFDTYVNWEFDPPVHHIGINQNSLSSLIYARWDPGSHSGKAVNVNVTYNSVSKNLSVF
WSFDGKAHHSLSYLVDLARVLPEFAAIGFSASFGRDPERHSVNSWEFTSDLDDVDEPRRL
WILVVVPTACFLLVIYARSCFLAVKRREKNGYIALTDIDKEIGALPTKFTYQELLAATNG
FTDDRRLGRGGSAQVYKGFLSHSNRLVAVKRIFAESRHSEKVFVNEVKIISRTIHRNLVP
FVGWCQEEGEFLLVYEYMPNGSLDHHLFGPRRSLPWAVRYGVALGLASALNYLHEELEQW
VLHRDIKAANVLLDTNFTTKLGDFGVAKLIDPQFRSQTTDVVGTCGYLAPEYFISGKATK
ESDMFSFGVVALEIACGRRGYKDGEVWVALHKWVWELYLAANILGAADEALGSGFRREEM
ECLMRVGLWCVHPDPARRPKAGQVIRFLQLEDSVPELPHDAFNGPVSHRPSASQLGILES
PSAPPIQESVFRKLDKSCLLKSYGNTC
Download sequence
Identical sequences A0A059AV04
Eucgr.H00062.1|PACid:23589387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]